PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00004213-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 171aa    MW: 20060.8 Da    PI: 6.6827
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00004213-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.55.3e-091131472155
                            HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            k +yp++ ++  LA+ +gL+++q+ +WF N+R ++
  SMil_00004213-RA_Salv 113 KWPYPTEVDKVTLAETTGLDQKQINNWFINQRKRH 147
                            569*****************************985 PP

2ELK26.12e-096788122
                    ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                           ELK++Llr Y+ +++sLk EFs
  SMil_00004213-RA_Salv 67 ELKDRLLRLYGDHINSLKLEFS 88
                           9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037912.9E-17137IPR005541KNOX2
SMARTSM012564.7E-11138IPR005541KNOX2
PfamPF037894.7E-56788IPR005539ELK domain
PROSITE profilePS512139.2376787IPR005539ELK domain
SMARTSM011883.5E-46788IPR005539ELK domain
PROSITE profilePS5007112.45587150IPR001356Homeobox domain
SuperFamilySSF466894.06E-1988160IPR009057Homeodomain-like
SMARTSM003893.3E-1189154IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.0E-2792151IPR009057Homeodomain-like
CDDcd000868.72E-1199151No hitNo description
PfamPF059201.7E-17107146IPR008422Homeobox KN domain
PROSITE patternPS000270125148IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
METYCDVLVK YKRDLSRPFD EATSFLNKIE NQLGNLCIDD GGLSSDEELS GGEAEANDPQ  60
MKTEDRELKD RLLRLYGDHI NSLKLEFSKK KKKGKLPKEA RQKLLEWWTV HYKWPYPTEV  120
DKVTLAETTG LDQKQINNWF INQRKRHWKP SENMHLAMME NLSGHLFMNG D
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071110.13e-97PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS66e-82KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLV5K9533e-88V5K953_9R
STRINGGLYMA01G03450.11e-81(Glycine max)
STRINGPGSC0003DMT4000350952e-81(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.12e-55KNOTTED1-like homeobox gene 6